logo babyonlineshop.ru BABYONLINESHOP.RU | Личный кабинет | Контакты | Доставка

Светильник Sonex 276

Цветок АРТИ-М (73 см) Тюльпан 23-276


Артикул - art_23-276, Бренд - АРТИ-М, Серия - Тюльпан, Время изготовления, дней - 1, Высота, мм - 730, Размер упаковки, мм - 730x50x50, Материал - полиэстер, Цвет - зеленый, оранжевый, Тип поверхности - матовый, Масса нетто, кг - 0.07

238 RUR

АРТИ-М (73 см) Тюльпан 23-276 похожие

Подробнее

New original DW-AV-623-M4-276.DW-AV-624-M4-276

Запчасть Shimano WH-RS31, 276 мм

KK-276 Магнит Овечка в асс шамот


KK-276 Магнит "Овечка" в асс шамот

179 RUR

КоКо Шамель похожие

Подробнее

Кольцо с 276 бриллиантами из белого золота


Кольцо с 276 бриллиантами из белого золота

232000 RUR

Джей ви похожие

Подробнее

Запчасть CN Spoke STD 14 2,0/276 мм

New original DW-AV-301-M4-276.DW-AV-302-M4-276

New original DW-AV-303-M4-276.DW-AV-304-M4-276

LS 276 6.5x15/5x112 D57.1 ET45 GMF

LS 276 6.5x15/5x112 D57.1 ET45 SF

Technical informaTion 2018 - Gestra

SMK 22. PN 10. 6. 1.4435. A276 316L2) 10.0. 1853). 10.0 / 20. 6.0 / 1853). SMK 22- ...... GAV 36F. PN 40. 2.9 4.9 7.8 15 25 39 61 78 105 130 210 350 570 860.

Реестр деклараций соответствия условий труда государственным ...

285, 276, 5/16/2016, Невско-Ладожский район водных путей и судоходства - филиала ФБУ "Администрации Волго-Балтийского бассейна внутренних ...

close coporations beslote korporasies - South African Government

GOV.ZA CAN BE VISITED FOR MORE INFORMATION. NO GUARANTEE IS ...... S K MANKUROAN GENERAL TRADING AND ...... WESTSIDE TRADING 276.

LCode Manual - NCJRS

2 сент. 1983 г. - Sylvan Industries, Inc. Taylor Boats. iKM. SLE. SMK. BRU. SNA. SIN. SPE. AXC ..... 276. 320. 400. 45. 55. 242. 280. 33. 404. 450. 577. 244. 297. 333. 41 ...... Gordoney. Galtinne Renette. Gatlina. Gallus. 3-24. Code. GAV. GAZ.

roc.chennai@mca.gov.in 28276652 Fax - Ministry Of Corporate Affairs

5 июл. 2017 г. - Email: roc.chennai@mca.gov.in. 28276652. Fax : 28280436 ... S K SHAKTI BUILDERS PRIVATE LIMITED .... 276 U28920TN1995PTC032665.

Математическое домино - цдоош

7 окт. 2018 г. - 276. КСА г. Кирово-Чепецк КОГОАУ «Гимназия №1». 73. 277. ССЗ г. Киров. МБОУ СОШ № 14. 72. 278. ДМС г. Киров. МБОУ «СОШ № 57».

FAQs - Bureau of Economic Analysis

6 дек. 2018 г. - 116, www.bea.gov/system/files/2018-12/trad-geo-FAQs.pdf ..... 32, 1999 4, 1,382, -8,150, -18,334, -1,426, -6,854, 276, -1,400, -3,201, -15,807 ...

Focus on the Future - Manitoba Education

27, Attn: Ruth Parnetta, Email: ruth.parnetta@gov.mb.ca. 28, 307-1181 ..... 276. 277. 278. 279. 280. 281. 282. 283. 284. 285. 286. 287. 288. 289. 290. 291. 292.

Danish University Colleges Implementeringen af flipped ... - UC Viden

require knew knowledge about the teachers PK, SMK, and beliefs and orientations. 2 ..... Åbne respons-felter gav lærerne mulighed for at give ...... Page 276 ...

Клатчи - Modnaya.ru

Модель: SMK(206)-GAV. Цена: 1990 руб. Производитель: ... Модель: SMK(202)-GAV. Цена: 1790 руб. .... Модель: SMK(276)-GAV. Цена: 1990 руб.

Untitled

276 300 (10). 1811 31}{), (10). 2. (бная стоимость << Товара »», 1ңзе гав.ляето (7 117 11:11:1ї сісце):11каци! Сізставляет 4}ни. 147.700n 600euncom Odw ...

Заворотнюк напрягала некоторыми местами - Tynu40k Goblina

24 нояб. 2007 г. - В главной роли кто? Заворотнюк? Беру! :) smk. Кому: smk, #250 ..... cheburaha. Кому: cheburaha, #276. отправлено 25.11.07 17:50, # 276 ...

S. No. Bank Name Centre Name and Address 1 J & K Bank ... - Uidai

13 сент. 2017 г. - sk education center, paigambarpur dera chowk, Saghari, Sagahari, Minapur, ..... 276. Punjab & Sind Bank. SSCOMPUTER AADHAR CENTER, B-307, GALI ..... patidar e services, patel market bercha gav rod bercha mandi, ...

Scanned Document - Gunnarns golfklubb

31 дек. 2010 г. - Kristina Pärnaste-Linder smk ... Överenskommelse mellan Gunnarns GK och Lycksele GK gav rabatt på årsgreenfee. Klubbfest .... 338 276,50 ...

SMK

If you do not have an account in the P2 Administration System, the email address becomes your login in the SMK. The first temporary password will be sent to ...Не найдено: 276SMK 11 FCO - ecoshave.ruhttps://ecoshave.ru/SMK-11-FCO/Сохраненная копияЦвет: красный. 1440 RUR. SMK(213)-GAV LacyWear ... 1890 RUR. SMK(117)-GAV LacyWear. LacyWear ..... 1990 RUR. SMK(276)-GAV LacyWear. LacyWear ...

MOD acronyms and abbreviations - Gov.uk

General Agreement on Tariffs and Trades. GAU. Gun Aircraft Unit. GAV ...... NRV. Net Realisable Value. NRV. Non Return Value. NRZ. Non-Return to Zero. 276 ...... Submarine Inspection Team smk smoke. SML. Surveying Motor Launch.

FAO species codes

276, 38, 1080400713, SMD, Mustelus mustelus, Smooth-hound, Émissole lisse, Musola ...... 1332, 23, 1231800101, GAV, Aplochiton zebra, Jenyns 1842, Galaxiidae ...... 7008, 33, 1781305901, SMK, Stlengis misakia, (Jordan & Starks 1904) ...

draft of SoER - Maharashtra Pollution Control Board

SMK-MC Sangli Miraj Kupwad Municipal Corporation. SMEs Small ...... 276. Hanuman Lake. 7.9. 80. 180 4.79. 418. Kalyan (2004). Kala Lake. 9.2 62.8 149.6.

Kiosk List - MPOnline लिमिटेड

244, SK CYBER, KAMAL RATHORE, PANWASA MAXI ROAD UJJAIN ... 276, PUBLIC ONLINE, SANDEEP KALERIYA, PUBLIC ONLINE, TEHSIL KARYALAY ...

03 Remove FGD Expenses - Kentucky Public Service Commission

167, 5550039, PJM Inadvertent Mtr Res-OSS, (82.61), 193.00, (276), (903.83) ...... 276, 9100001, Misc Cust Svc & Info Exp - RCS, 261.77, 79.00, 183, 598.83 ...

महाराष्ट्र राज्यातील नोंदणीकृत शेतकरी उत्पादक

4 нояб. 2008 г. - dhartisamrudhifpcl@gmail.com S. K. Jadhav. 9922667550. 267 ... 276. U01403MH2016PTC272253. SANT NARAYAN MAHARAJ FARMER.

gestra - Alnab

SMK 22. PN 10. 6. 1.4435. A276 316L2) 10.0. 1853). 10.0 / 20. 6.0 / 1853) ...... GAV 54F. PN 16, 25 4.8 8.3 11.9 19.9 27.1 43 75 117 172.3 171 204 457 714 ...

Sheet1 - Sebi

276, 260, CHATTISGARH, Bilaspur, Bilaspur, Gaj Mohini, Shiv Talkies Bus ...... Perumkulam, S K Building, P O Poovachal, Perumkulam, 695575, Manager, 0472 ...

post-gst afd dealer contact details please contact nearest depot for ...

PLOT NO-81, AGDALA GAON, BAIHATA. CHARIALI ...... 7299609999. 276. CHENNAI. M/S ROYAL ENFIELD MOTORS LTD. M/S SRI VELAVAN MOTORS PVT. .... M/S WHIRLPOOL OF INDIA LIMITED M/S M K ENTERPRISES. SEC 1, B-20, ...

DriveArchive - Vehicle History and Fate - Registrations

... (123 DMS) 123DS (123 DS) 123GOV (123 GOV) 123GWC (123 GWC) 123HCK .... 18MU (18 MU) 18PWL (18 PWL) 18SGB (18 SGB) 18SK (18 SK) 18UKP (18 ..... 276AJO (276 AJO) 276BWX (276 BWX) 276DMD (276 DMD) 276EAC (276 ...

Opretholdelse af yngre personers livspraksis når de lider af ...

4 февр. 2013 г. - Socialministeriet gav i 2002-2003 amterne mulighed for at ansøge om ..... 276). 1.6.3.3 Én interessant og relevant omvej. I forsøg på at uddybe ...

Pending Appication 1-07-2018

30 июн. 2018 г. - NO. 2352, SY.N.276 OF ARAGINADONI ...... S K Steel Tech. Plot No 47,48,49, ..... Plot No.276P & 277P,P-II,KIADB Industrial. Area, Harohalli ...

coo» 349,61.-3-1 - OSTI.GOV

GAV. This selects the option on the evaluation of the single particle level density. If GAV is zero ..... 274. IU=E. 275. SUM=0. 276. IF (N- 3) 820,846,820. 277... 846. If(E-POT)820,820,850. 278. 820. IU=E ..... SRN=SMK+SCRS(KE,1). 409. 11G5.

Furniture Barn & Manor House - Collection List - Cheshire ...

(12 Items) · Gavin - GVLP-001 (1 Items) · Gemini - GMN .... (2 Items) · Koa - KOA-276 (2 Items) · Kodari - KDI ..... (1 Items) · Soumek - SMK (7 Items) · Spanish ...

Making the Mission Computer Intelligent – A Step Ahead | Pitchammal ...

Increasing the complexity of fighter aircraft like modern cockpit environments, covering highly integrated, and complex automatic functions, pose various ...

CIP-Tool - Ouray County

290, 276, FALSE, 91, WATERVIEW, WATERVIEW DR, 100 ..... 76, xGOVSPRGSRD, 46, 11, GOV'T SPRINGS RD, 100, BGN, N, NCOLI, 4, 4, 1, 5.6, 29,568, 24 ...

Second EB Examination for Officers in Sri Lanka Principals Service

113 PRIYANGANI, G.A.V.. PREETHI, BATAATA, ..... 276 WARNASOORIYA, W.M.C.. 722, MODER ESTATE, ..... 478 BANDARA, S.M.K.. GEDARA KUMBURA ...

Фрагмент каталога выставки «Евразия-2018 - РКФ

6 мая 2018 г. - RKF 4352121, LV 36247/15 (276/15),. , UKU.0195936 ..... RKF 5140069, , GAV 9295. Класс Юниор ...... RKF 4823367, , SMK 7. RKF 5039335 ...

(PDF) The Lasiocampidae of Iran (Lepidoptera) - ResearchGate

18 авг. 2018 г. - SMK Staatliches Museum für Naturkunde, Karlsruhe, Germany. SMNS Staatliches ..... Abai M.; Gavkoshak, Kazerun, 14–. 24.X.1975, leg.

NCBI CDD Conserved Protein Domain PRK09355

9 дек. 2010 г. - ... DELKVITKMANGLLVNIGTLEPYQMESSMISMKIA 75 gi 28211402 6 .[5]. .... FIGAVS 227 gi 25028148 152 ... 276 gi 25028148 222 AHAHLGAAGRIAATRA T APGSYAVALIDALHQLDRNQLANLTHLR.[2]. 268 gi 297544131 ...

Information About... - Federal Direct Loans - US Department of Education

sMK) zM[F QsAI WU\G ]M6y9l pNOB9 q*0$g #,A- k^3\ 0(12 Ipd! U?*V<+ })j8 Wy\/ ..... B[#8 ppx8' 0rzph qSV^ wD>a Z+2mb I,@\pG F=0p=I?t GR1Z GaV- '=kD ...... 0 obj /Length 276 0 R stream endstream endobj 276 0 obj endobj 273 0 obj /Type ...

briefing book - Geological Survey of India

31 мар. 2015 г. - S.M.K. Kazimi,. Director. STM/SR/AP/2014/ ...... into Gov. a/c, vide. Scroll No. 240780, dt. 13.02.15. Geologist. 7453. 04.10.14. 7710. 13.11.14 ...... 276/C dated. 14.07.20. 14. Final adjustment bill sent to PAO,. SR, Hyderabad.

APL Card Status(South)

A - 276. TIGRI. NEW DELHI - 110062. 47. 33. APL33010356 RUP CHAND. SANT RAM ...... 19 GAV DEVALI NIYAR. PURANI ...... LATE SRI S K NISHAD. B 1338.

:&?f '*?w (?DJ%?U >D|M> s?^f ?f.d? ><?U ?U(#? ,?wE6?U ??f!I?D R ...

HARFKA PA/kSA XA|[ZA aA McAi gA0$gAC gA""hAN eArheA xeAU yAv[|A ...... SK@j 1@%9*@ r#@d %@(D(@ S3@| 6@2r:@4 <@h[:@ _3@ea/@w ls? ...... 5?276? B;?^*<? X>?L n??z @?9X@? A?*QA? B?dKC? C?$WD?m dE?m H?eJI?

Gun Data Codes - State of Michigan

Corp./Survival Arms. Armament Technology Corp. US. ARH. Armand Gavage. BG. GAV. Armand Mieg. --. MIE ...... SMK. Smoker. US. IJ. Model of Iver Johnson. Smythe, John M., Mdes., (or Hdw.) Co. US. SMO. Various mfrs. ...... Page 276 ...

(Systemie Monitorowania Kształcenia) www.smk.ezdrowie.gov.pl ...

Przed wypełnieniem wniosku w SMK (Systemie Monitorowania Kształcenia) www.smk.ezdrowie.gov.pl przeczytaj ten komunikat. W przypadku, gdy we wniosku ...Не найдено: 276ФАС Россииhttps://fas.gov.ru/Сохраненная копияО ФАС России · Миссия, цели, ценности · Услуги и функции · Структура · Государственная служба · Противодействие коррупции · Федеральные ...Не найдено: smk ‎276[PDF]SMK Årskonferens 2014 - Equmeniakyrkanhttps://equmeniakyrkan.se/.../SMK-konferens-2014-för-web...Сохраненная копияПеревести эту страницу8 февр. 2014 г. - material från SMK:s huvudarkiv på Riksarkivet varav cirka 75 % är klart. Utöver huvudarkivet finns ..... Flytten av pastorsutbildningen gav utrymme för en ny satsning. Missionskyrkan gick ...... 378 703. 4 276 422. Avsättning till ...

Daily News from New York, New York on August 14, 1979 · 276

14 авг. 1979 г. - Tuesday, August 14, 1979 Pilar Pice 7 0 0 J T OTIMImMMttiMfflkinlEFOIIEWiKraMM POST 1:3 OPEDT 0 0 0 ft Aene 3- 1 121 4- 1 5- 1 t -SO.

Download - Pfam

STOCKHOLM 1.0 #=GF ID BCAS3 #=GF AC PF12490.8 #=GF DE Breast carcinoma amplified sequence 3 #=GF AU Gavin OL; #=GF GA 21.7 21.7 #=GF NC ...

Lacy 5 • Женские сумки • Совместные покупки SuperPuper

Самый быстрый сбор сп закупок по всей России с дозаказом. Купить товары по оптовой цене. Верхняя одежда, косметика, обувь для женщин, для мужин ...

MUNICIPAL CORPORATION OF GREATER MUMBAI Sub : List of ...

S.K.Patil Udyan, M.K.Road, Bhai jivanji Rd, Mumbai 400 002. ...... 276. H/W. 2086. Garden. 277. H/W. 588. Garden. 278. H/W. Garden. 10602. Garden. 279. H/W.

Salvator Rosas Demokrit og Diogenes i København - Perspective - SMK

19 мар. 2017 г. - 456 x 276 mm. ... KKSgb13525. public domain, SMK. .... Kr.) sagde man, at han levede 'som en hund', hvilket gav navn til den kyniske skole ...

Team Seifert-Salk Speedway #276 - Sports League - Jægerspris ...

Team Seifert-Salk Speedway #276, Jægerspris. 472 likes · 82 talking about this. #276 Team Jonas Seifert-Salk Speedway.

REES 2017 annual report - time series data - ESCOSA

2 авг. 2018 г. - 28, http://www.governmentgazette.sa.gov.au/sites/default/files/ ..... 2,939, 0, 2,939, 260, 2,679, 1030%, 276, 2679, 2,955, 1,943, 1,012, 152%.

List Of School (Seat Full) - Right to Education|Home

276, BALLIA, DAYANAND V.MANDIR BALLIA, 17, 17. 277, BALLIA, JISAS ...... 1084, LUCKNOW, HAPPY HOURS HSS S M K CHOWK LUCKNOW, 10, 10. 1085, LUCKNOW ...... SAMITI JHS, BANGLA GAON, 12, 12. 1728, MORADABAD ...

ocurence frequency of all ligands in BioLiP - The Yang Zhang Lab

... 104 B12 285 105 FMT 283 106 U10 281 107 U5P 276 108 XYS 276 109 HIS ..... 12 1791 065 12 1792 GAV 12 1793 4ZN 12 1794 TZP 12 1795 BU4 12 1796 ..... 6 3766 6KG 6 3767 2CO 6 3768 IUM 6 3769 SMK 6 3770 3HR 6 3771 ETS 6 ...

List of candidates for recruitment to various para medical posts - Esic

271, 269, STAFF NURSE, GAURAV MUKERJI, SK MUKERJI, G-7 LADY HOSP. ... 278, 276, LAB ASSISTANT, GIRDHAR KUMAR, SUBHASH CHAND, 7/5/1982, VL. ...... KAROLI MATA,MAHAL GAON RI TRAINING SCHOOL KE PICHE,NR.

MA - Minnesota.gov

3311, Laboratory & Radiology, 1,113, 1,136, 1,195, 1,258, 1,324. 3312, Rehabilitation Serv. 26, 27, 28, 29, 31. 3313, Prescription Drugs, 276, 288, 310, 334, 360.

ВИДЕО СМК - OK.RU

00:35. Нормальная молодёжь. 297 805 просмотров. 11:15. 33 ПРОСТЫХ СЕКРЕТА КРАСОТЫ. Легко и Просто! 1 319 276 просмотров.NCBI CDD Conserved Protein Domain Nup153https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid...Сохраненная копияПеревести эту страницу16 июл. 2015 г. - ... 263 gi 47229394 276 .... 454 -SARVSMKRHEEDGq----pELPDLPTVSLPI-STSALPTFSFTSP-LPaSVIGNSS------SITVTPGKE-----V-- 513 gi ...

VHA List by VISN - VA.gov

... Column273, Column274, Column275, Column276, Column277, Column278 ...... 3, 1, Togus Maine, 402, Ann Russo, 207-623-8411, Ann.Russo@va.gov.

10-16 мая - Министерство образования и науки Республики ...

Казани, ул. Бигичева, 26, 276-26-21: Е-mail: sch174@mail.ruФилиппов Евгений Сергеевич16 лет, 9 классИгра "Эрудит"Пискунова Аида Тагировнаучитель ...

Клатчи женские интернет магазин Lacywear в Москве

Клатч. 1990 руб. 1612 руб. по промокоду. Размеры: 1. Клатч SMK(277)-GAV. Клатч. 1440 руб. 1166 руб. по промокоду. Размеры: 1. Клатч SMK(276)-GAV.

НАУЧНЫЕ ТРУДЫ Северо-Западного института управления ...

http://gov.spb.ru/Files/file/_as_pravoporyadok_v%20raionah%20spb_9% ...... 276. Научные труды СЗИУ РАНХиГС. Том 5. Выпуск 1 (13). Литература. 1.

Лист1

274, 26/, 10671, 5/31/2011, ООО "ЦентроБалт". 275, 26/, 1706, 11/22/2010, ООО "МОБИС МОДУЛЬ СНГ". 276, 26/, 333, 20.10.10, ООО "БалтЭнергоСтрой".

Сумма, руб. № п/п Сч ет ТМЦ кол-во Цена, руб за еденицу Сч.201 ...

29 июл. 2015 г. - 3698,92. 14795,66. 276 201 ЦВК - 4\85. 2. 1923,43. 3846,87. 277 201 К - 45\30 (бр). 2. 1479,57. 2959,13. 278 201 К - 45\30 (нов). 2. 3622,80.

gestra - Barthel Armaturen

SMK 22. PN 10. 6. 1.4435. A276 316L2) 10.0. 1853). 10.0 / 20. 6.0 / 1853). SMK 22- ...... GAV 36F. PN 40. 2.9 4.9 7.8 15 25 39 61 78 105 130 210 350 570 860.

NCIC 2000 Code Manual with TOUs incorporated - Oregon.gov

Page 276 ...... Sleek Craft Boats. SLE. Small Craft, Inc. LCX. Smoker Lumber Co., Inc. SMK. Smoker-Craft (New Paris, IN). SUN. Smyrna Skiffs. BRU.

Defense Contract Action Data System - The National Archives Catalog

29 мая 1997 г. - 268-276. 9n9n. Number. Number ofofactions actions (1057 data/. (1057 datal ...... SMJ. SMK. SMK. SML. SML .1.> M. > '1. NARA Reference Page #62 ...... GAC. AN/ALQ-26. AN/ALQ-26 PAVE. PAVE TACK. TACK. GAV. GAV.

De berørtes synspunkter - Regjeringen.no

22 июл. 2018 г. - 276. NOU 2012:14. Kapittel 11. Rapport fra 22. juli-kommisjonen etter 22/7. Også AUF og ..... sjon) mellom politidistrikt. Gav ingen tilbake-.

185B - JSE

23 апр. 2018 г. - 24, Bloemhof, 276, SWL, 55519, Heilbron, 172, SWK, 54764. 25, Bodenstein, 158, NWK, 51891, Hendriksvallei Bunker*, 296, AFG, 67988.

Velosipedy 276. Клатчи - Modnaya.ru

Модель: SMK(206)-GAV. Цена: 1990 руб. Производитель: ... Модель: SMK(202)-GAV. Цена: 1790 руб. .... Модель: SMK(276)-GAV. Цена: 1990 руб.

T MU AM 01007 TI - Transport for NSW

276, MVY, Mt Victoria Up Yard, 126.913, 127.920, Active, Yard, Heavy Rail ...... 1647, GAV, Glenbawn Dam, Location, NSW, Active, x, new addition of ...... 4002, SMK, Smiths Lake, Location, NSW, Active, x, new addition of waterway location.

<SEC-DOCUMENT>0000950103-12-005929.txt : 20121106 <SEC ...

... documents for free by visiting EDGAR on the SEC Web site at www.sec.gov. ...... _B+P M'IEQXBM+^34_#45SI=MX7T;5;C1Q>?V:;.3H_C+^W%^S7^SK\9?`

rNRXN_090612_S3.sqt - The Scripps Research Institute

Xu T, Venable JD, Park SK, Cociorva D, Lu B, Liao L, Wohlschlegel J, Hewel J, Yates ... DVD L IPI:IPI00829467.1|TREMBL:A1L113|ENSEMBL: 276 NKR. ...... GAV S 8071 8071 2 6301 node1003_Thread-0 1664.73767 656.70 0.0292 67701 ...

Nyhavn 10-10a-12-12a-b - Indenfor voldene

Matrikelnummer: 276, Øster Kvarter ... 1862 – Statens Museum for Kunst, www.smk.dk – public domain ... økonomisk-videnskabeligt forfatterskab indenfor land-, have- og skovbrug, statsøkonomi samt historie gav Olufsen stor anerkendelse.

-----BEGIN PRIVACY-ENHANCED MESSAGE----- Proc-Type: 2001 ...

... MESSAGE----- Proc-Type: 2001,MIC-CLEAR Originator-Name: webmaster@www.sec.gov ...... SK#B+R:7YCW2K M-J)%1Y0M`CBW**\RCSBKXW9CPCUN3B.

Velosipedy 276. Клатчи женские интернет магазин Lacywear в Москве

Клатч. 1990 руб. 1612 руб. по промокоду. Размеры: 1. Клатч SMK(277)-GAV. Клатч. 1440 руб. 1166 руб. по промокоду. Размеры: 1. Клатч SMK(276)-GAV.

Vacant For-Sale Units, by Selected Characteristics - Census Bureau

276 ..1939 or earlier.............................. 15, 15, 14, 13, 13, 13, 13, 14, 13, 14. 277. 278, Sales price. 279, specified total1............................. 100, 100, 100, 100, 100 ...

Pfam: SLATT_1 - GenomeNet

... #=GS A0A1V0PUA2_9RHOB/176-307 AC A0A1V0PUA2.1 #=GS A0A0M8TXG3_9ACTN/156-276 AC A0A0M8TXG3.1 #=GS A0A0C2LWC5_9CYAN/169-291 ...

Совместные покупки - Саратов - СП : Каталог LACYWEAR ...

SMK(82)-CHK. 1140, 1345, Женщинам » Сумки » .... SMK(177)-GAV. 1440, 1699, Женщинам » .... SL3733524. 234, 276, Женщинам » Белье » Носки.

Крест из серебра КС-276


Артикул: КС-276 Металл: Серебро Ag 925 Вставка: Без вставок

1790 RUR

похожие

Подробнее

ED-276 Фигурка Обезьяны


ED-276 Фигурка "Обезьяны"

592 RUR

Noname похожие

Подробнее

Rondell Mocco RDA-276 24 см


Сковорода Rondell Mocco RDA-276. Диаметр 24 см. Материал - штампованный алюминий. Толщина стенок - 3.5 мм. Толщина дна - 3.5 мм. Форма - круглая. Ручки - 1 длинная. Титановое антипригарное покрытие TriTitan Spectrum.

3490 RUR

Rondell Mocco RDA-276 24 см похожие

Подробнее

5 pieces HTD3M 276 15 timing belt teeth 92 width 15mm length 276mm rubber closed-loop 276-3M-15 HTD 3M for electric planer

Швейная машина JAGUAR 276


Тип управления: электромеханический Тип челнока: вертикальный Выполнение петли: полуавтомат Количество швейных операций: 8 Максимальная длина стежка (мм): 4 Гарантия: 1 год

5827 RUR

JAGUAR 276 похожие

Подробнее

Rondell Сковорода Mocco&Latte, 24 см, без крышки RDA-276

Чайник электрический UNIT UEK-276, сталь, Матовый, 1.7л., 2000Вт.

Скад KL-276 Nissan X-Trail 7x18/5x114.3 D66.1 ET45 Black_matt

RV-276 Фигурка Счастливая лунка (W.Statford)


RV-276 Фигурка "Счастливая лунка" (W.Statford)

1593 RUR

The Comical World of Warren Stratford похожие

Подробнее

Молоток с прямым гвоздодером Stanley Fatmax Antivibe FMHT1-51276 1-51-276


Материал: сталь Длина (мм): 325 Страна-производитель: Мексика

2990 RUR

Stanley Fatmax Antivibe FMHT1-51276 1-51-276 похожие

Подробнее

Скад KL-276 Nissan X-Trail 7x18/5x114.3 D66.1 ET45 Silver

MBX-276 Mainboard For Sony MX-276 SVE14A SVE14 Series A1898116A 216-0833000 2G Laptop Motherboard DDR3 100% Tested Free Shipping

Комментарии




Подпишитесь на новинки нашего магазина babyonlineshop.ru